| Primary information |
|---|
| ID | 17262 |
| Uniprot ID | P01579 |
| Description | Interferon gamma (IFN-gamma) (Immune interferon) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Released primarily from activated T lymphocytes. |
| Post Translational Modification | Proteolytic processing produces C-terminal heterogeneity; with proteins ending alternatively at Gly-150; Met-157 or Gly-161. |
| Function | Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial; antiviral; and antitumor responses by activating effector immune cells and enhancing antigen presentation |
| Length | 166 |
| Molecular Weight | 19348 |
| Name | Interferon gamma |
| Sequence | DPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG |
| Sequence map | 26-41 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P15260; P38484 |
| Domain | NA |
| Pharmaceutical Use | Available under the name Actimmune (Genentech). Used for reducing the frequency and severity of serious infections associated with chronic granulomatous disease (CGD).
|