| Primary information |
|---|
| ID | 17256 |
| Uniprot ID | P01233 |
| Description | Choriogonadotropin subunit beta 3 (Choriogonadotropin subunit beta) (CG-beta) (Chorionic gonadotropin chain beta) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed continuously during the whole pregnancy with a peak during the first trimester. |
| Similarity | NA |
| Tissue Specificity | High expression in the placenta throughout pregnancy. |
| Post Translational Modification | NA |
| Function | Beta subunit of the human chorionic gonadotropin (hCG). hCG is a complex glycoprotein composed of two glycosylated subunits alpha and beta which are non-covalently associated. The alpha subunit is identical to those in the pituitary gonadotropin hormones (LH; FSH and TSH). The beta subunits are distinct in each of the hormones and confer receptor and biological specificity. Has an essential role in pregnancy and maternal adaptation. Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. |
| Length | 165 |
| Molecular Weight | 17739 |
| Name | Choriogonadotropin subunit beta 3 |
| Sequence | KEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
| Sequence map | 23-45 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P22888 |
| Domain | NA |
| Pharmaceutical Use | NA
|