| Primary information |
|---|
| ID | 17255 |
| Uniprot ID | Q16627 |
| Description | C-C motif chemokine 14 (Chemokine CC-1/CC-3) (HCC-1/HCC-3) (HCC-1(1-74)) (NCC-2) (Small-inducible cytokine A14) [Cleaved into- HCC-1(3-74); HCC-1(4-74); HCC-1(9-74)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed constitutively in several normal tissues- spleen; liver; skeletal and heart muscle; gut; and bone marrow; present at high concentrations |
| Post Translational Modification | The N-terminal processed forms HCC-1(3-74); HCC-1(4-74) and HCC-1(9-74) are produced in small amounts by proteolytic cleavage after secretion in blood.; HCC-1(1-74); but not HCC-1(3-74) and HCC-1(4-7 |
| Function | Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca(2+) changes and enzyme release; but no chemotaxis; at concentrations of 100-1;000 nM; and is inactive on T-lymphocytes; neutrophils; and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes; eosinophils; and T-cells and is a ligand for CCR1; CCR3 and CCR5. |
| Length | 93 |
| Molecular Weight | 10678 |
| Name | C-C motif chemokine 14 |
| Sequence | KTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Sequence map | 21-33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P32246; P51677; P51681 |
| Domain | NA |
| Pharmaceutical Use | NA
|