| Primary information |
|---|
| ID | 17253 |
| Uniprot ID | Q99075 |
| Description | Proheparin-binding EGF-like growth factor [Cleaved into- Heparin-binding EGF-like growth factor (HB-EGF) (HBEGF) (Diphtheria toxin receptor) (DT-R)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Heparin-binding EGF-like growth factor]- Secreted; extracellular space. Note=Mature HB-EGF is relea |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | Several N-termini have been identified by direct sequencing. The forms with N-termini 63; 73 and 74 have been tested and found to be biologically active.; O-glycosylated with core 1 or possibly core |
| Function | Growth factor that mediates its effects via EGFR; ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts; but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. |
| Length | 208 |
| Molecular Weight | 23067 |
| Name | Proheparin-binding EGF-like growth factor |
| Sequence | VTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH |
| Sequence map | 23-28 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P78536; P21926; P00533; Q15303 |
| Domain | NA |
| Pharmaceutical Use | NA
|