| Primary information |
|---|
| ID | 17245 |
| Uniprot ID | P39905 |
| Description | Glial cell line-derived neurotrophic factor (hGDNF) (Astrocyte-derived trophic factor) (ATF) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | In the brain; predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. |
| Post Translational Modification | NA |
| Function | Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. |
| Length | 211 |
| Molecular Weight | 23720 |
| Name | Glial cell line-derived neurotrophic factor |
| Sequence | PDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Sequence map | 81-31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P56159; O00451 |
| Domain | NA |
| Pharmaceutical Use | NA
|