| Primary information |
|---|
| ID | 17244 |
| Uniprot ID | O60383 |
| Description | Growth/differentiation factor 9 (GDF-9) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in ovarian granulosa cells. Present in oocytes of primary follicles |
| Post Translational Modification | Phosphorylated; phosphorylation is critical for GDF9 function. In vitro; can be phosphorylated by CK at Ser-325. |
| Function | Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases; through an increase of CCND1 and CCNE1 expression; and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells. |
| Length | 454 |
| Molecular Weight | 51444 |
| Name | Growth/differentiation factor 9 |
| Sequence | QETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR |
| Sequence map | 327-34 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q13873 |
| Domain | NA |
| Pharmaceutical Use | NA
|