| Primary information |
|---|
| ID | 17240 |
| Uniprot ID | Q9NR23 |
| Description | Growth/differentiation factor 3 (GDF-3) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | Synthesized as large precursor molecule that undergo proteolytic cleavage; releasing the pro-domain from the active; receptor binding; C-terminal region of the molecule. |
| Function | Growth factor involved in early embryonic development and adipose-tissue homeostasis. During embryogenesis controls formation of anterior visceral endoderm and mesoderm and the establishment of anterior-posterior identity through a receptor complex comprising the receptor ACVR1B and the coreceptor TDGF1/Cripto. Regulates adipose-tissue homeostasis and energy balance under nutrient overload in part by signaling through the receptor complex based on ACVR1C and TDGF1/Cripto |
| Length | 364 |
| Molecular Weight | 41387 |
| Name | Growth/differentiation factor 3 |
| Sequence | AIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG |
| Sequence map | 257-04 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q8NER5; P36896 |
| Domain | NA |
| Pharmaceutical Use | NA
|