| Primary information |
|---|
| ID | 17233 |
| Uniprot ID | P17931 |
| Description | Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes. |
| Post Translational Modification | NA |
| Function | Galactose-specific lectin which binds IgE. May mediate with the alpha-3; beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1; required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus- acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion; chemoattraction of monocytes macrophages; opsonization of apoptotic neutrophils; and activation of mast cells. Together with TRIM16; coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. |
| Length | 250 |
| Molecular Weight | 26152 |
| Name | Galectin-3 |
| Sequence | DNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
| Sequence map | 6-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P09564; P05556 |
| Domain | NA |
| Pharmaceutical Use | NA
|