| Primary information |
|---|
| ID | 17227 |
| Uniprot ID | P31371 |
| Description | Fibroblast growth factor 9 (FGF-9) (Glia-activating factor) (GAF) (Heparin-binding growth factor 9) (HBGF-9) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Glial cells. |
| Post Translational Modification | Three molecular species were found (30 kDa; 29 kDa and 25 kDa); cleaved at Leu-4; Val-13 and Ser-34 respectively. The smaller ones might be products of proteolytic digestion. Furthermore; there may be |
| Function | Plays an important role in the regulation of embryonic development; cell proliferation; cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development; gliosis during repair and regeneration of brain tissue after damage; differentiation and survival of neuronal cells; and growth stimulation of glial tumors. |
| Length | 208 |
| Molecular Weight | 23441 |
| Name | Fibroblast growth factor 9 |
| Sequence | GEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Sequence map | 7-28 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P11362; P21802; P22607; P22455 |
| Domain | NA |
| Pharmaceutical Use | NA
|