| Primary information |
|---|
| ID | 17219 |
| Uniprot ID | O95750 |
| Description | Fibroblast growth factor 19 (FGF-19) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in fetal brain; cartilage; retina; and adult gall bladder. |
| Post Translational Modification | NA |
| Function | Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression; following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4. |
| Length | 216 |
| Molecular Weight | 24003 |
| Name | Fibroblast growth factor 19 |
| Sequence | AFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Sequence map | 28-36 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P22455; Q86Z14 |
| Domain | NA |
| Pharmaceutical Use | NA
|