| Primary information |
|---|
| ID | 17214 |
| Uniprot ID | P05230 |
| Description | Fibroblast growth factor 1 (FGF-1) (Acidic fibroblast growth factor) (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin-binding growth factor 1) (HBGF-1) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted Cytoplasm. Cytoplasm; cell cortex. Cytoplasm; cytosol. Nucleus. Note=Lacks a cleavable sign |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle. |
| Post Translational Modification | In the nucleus; phosphorylated by PKC/PRKCD. |
| Function | Plays an important role in the regulation of cell survival; cell division; angiogenesis; cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins; leading to the activation of several signaling cascades. Binds to integrin ITGAV-ITGB3. Its binding to integrin; subsequent ternary complex formation with integrin and FGFR1; and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1; FRS2; MAPK3/ERK1; MAPK1/ERK2 and AKT1 |
| Length | 155 |
| Molecular Weight | 17460 |
| Name | Fibroblast growth factor 1 |
| Sequence | NLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Sequence map | 18-35 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q92896; P11362; P21802; P22607; P22455 |
| Domain | NA |
| Pharmaceutical Use | NA
|