| Primary information |
|---|
| ID | 17211 |
| Uniprot ID | P52798-2 |
| Description | Ephrin-A4 (EPH-related receptor tyrosine kinase ligand 4) (LERK-4) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Isoform 1]- Cell membrane; Lipid-anchor; GPI-anchor.; [Isoform 2]- Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in the adult spleen; lymph node; prostate; ovary; small intestine; and colon; and in fetal heart; lung; liver and kidney. Also detected in hematopoietic cell lines. |
| Post Translational Modification | NA |
| Function | Cell surface GPI-bound ligand for Eph receptors; a family of receptor tyrosine kinases which are crucial for migration; repulsion and adhesion during neuronal; vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells; leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. |
| Length | 201 |
| Molecular Weight | 22386 |
| Name | Ephrin-A4 |
| Sequence | RHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGES |
| Sequence map | 28-50 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9UF33 |
| Domain | NA |
| Pharmaceutical Use | NA
|