| Primary information |
|---|
| ID | 17204 |
| Uniprot ID | Q9UBT3 |
| Description | Dickkopf-related protein 4 (Dickkopf-4) (Dkk-4) (hDkk-4) [Cleaved into- Dickkopf-related protein 4 short form] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in cerebellum; T-cells; esophagus and lung. |
| Post Translational Modification | Appears to be not glycosylated.; Can be proteolytically processed by a furin-like protease. |
| Function | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development; where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning; limb development; somitogenesis and eye formation. In the adult; Dkks are implicated in bone formation and bone disease; cancer and Alzheimer disease. |
| Length | 224 |
| Molecular Weight | 24876 |
| Name | Dickkopf-related protein 4 |
| Sequence | VLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL |
| Sequence map | 22-44 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q8NCW0 |
| Domain | The C-terminal cysteine-rich domain mediates inter |
| Pharmaceutical Use | NA
|