Primary information |
---|
ID | 17199 |
Uniprot ID | O14625 |
Description | C-X-C motif chemokine 11 (Beta-R1) (H174) (Interferon gamma-inducible protein 9) (IP-9) (Interferon-inducible T-cell alpha chemoattractant) (I-TAC) (Small-inducible cytokine B11) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | High levels in peripheral blood leukocytes; pancreas and liver astrocytes. Moderate levels in thymus; spleen and lung. Low levels in placenta; prostate and small intestine. Also found in epidermal bas |
Post Translational Modification | NA |
Function | Chemotactic for interleukin-activated T-cells but not unstimulated T-cells; neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. |
Length | 94 |
Molecular Weight | 10365 |
Name | C-X-C motif chemokine 11 |
Sequence | PMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Sequence map | 23-34 |
PDB ID | NA |
Drugpedia | NA |
Receptor | P49682 |
Domain | NA |
Pharmaceutical Use | NA
|