| Primary information |
|---|
| ID | 17194 |
| Uniprot ID | Q99969 |
| Description | Retinoic acid receptor responder protein 2 (Chemerin) (RAR-responsive protein TIG2) (Tazarotene-induced gene 2 protein) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed at the highest levels in placenta; liver; and white adipose tissue |
| Post Translational Modification | Secreted in an inactive precursor form; prochemerin; which is proteolytically processed by a variety of extracellular proteases to generate forms with differing levels of bioactivity. For example; the |
| Function | Adipocyte-secreted protein (adipokine) that regulates adipogenesis; metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Acts also as a ligand for CMKLR2. Can also bind to C-C chemokine receptor-like 2 (CCRL2); but with a lower affinity than it does to CMKLR1 or CMKLR2 |
| Length | 163 |
| Molecular Weight | 18618 |
| Name | Retinoic acid receptor responder protein 2 |
| Sequence | LTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS |
| Sequence map | 23-37 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q99788 |
| Domain | NA |
| Pharmaceutical Use | NA
|