| Primary information |
|---|
| ID | 17188 |
| Uniprot ID | O00585 |
| Description | C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Highly expressed in high endothelial venules of lymph nodes; spleen and appendix. Intermediate levels found in small intestine; thyroid gland and trachea. Low level expression in thymus; bone marrow; |
| Post Translational Modification | NA |
| Function | Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells; but not for B-cells; macrophages; or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. |
| Length | 134 |
| Molecular Weight | 14646 |
| Name | C-C motif chemokine 21 |
| Sequence | DGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
| Sequence map | 26-14 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9NPB9; P32248 |
| Domain | NA |
| Pharmaceutical Use | NA
|