| Primary information |
|---|
| ID | 17181 |
| Uniprot ID | P22003 |
| Description | Bone morphogenetic protein 5 (BMP-5) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in the lung and liver. |
| Post Translational Modification | NA |
| Function | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes; including cartilage and bone formation or neurogenesis |
| Length | 454 |
| Molecular Weight | 51737 |
| Name | Bone morphogenetic protein 5 |
| Sequence | ANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH |
| Sequence map | 324-34 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q04771 |
| Domain | NA |
| Pharmaceutical Use | NA
|