| Primary information |
|---|
| ID | 17180 |
| Uniprot ID | O95390 |
| Description | Growth/differentiation factor 11 (GDF-11) (Bone morphogenetic protein 11) (BMP-11) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | In the embryo; strong expression is seen in the palatal epithelia; including the medial edge epithelial and midline epithelial seam of the palatal shelves. Less pronounced expression is also seen thro |
| Post Translational Modification | Synthesized as large precursor molecule that undergoes proteolytic cleavage by furin-like proteases (PubMed-31215115). This produces an inactive form consisting of the mature C-terminal portion non-co |
| Function | Secreted signal that acts globally to regulate anterior/posterior axial patterning during development. May play critical roles in patterning both mesodermal and neural tissues. It is required for proper vertebral patterning and orofacial development |
| Length | 407 |
| Molecular Weight | 45091 |
| Name | Growth/differentiation factor 11 |
| Sequence | LGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
| Sequence map | 305-47 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P27037 |
| Domain | NA |
| Pharmaceutical Use | NA
|