| Primary information |
|---|
| ID | 17179 |
| Uniprot ID | P35070 |
| Description | Probetacellulin [Cleaved into- Betacellulin (BTC)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Betacellulin]- Secreted; extracellular space.; [Probetacellulin]- Cell membrane; Single-pass type I |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine. |
| Post Translational Modification | NA |
| Function | Growth factor that binds to EGFR; ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. |
| Length | 178 |
| Molecular Weight | 19746 |
| Name | Probetacellulin |
| Sequence | GNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA |
| Sequence map | 34-58 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | O14672; P00533; Q15303 |
| Domain | NA |
| Pharmaceutical Use | NA
|