| Primary information |
|---|
| ID | 17173 |
| Uniprot ID | Q5T4W7 |
| Description | Artemin (Enovin) (Neublastin) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed during embryogenesis. High level expression seen in fetal kidney and lung while a low level expression seen in the fetal brain. |
| Similarity | NA |
| Tissue Specificity | Ubiquitous. Expressed at high levels in peripheral tissues including prostate; placenta; pancreas; heart; kidney; pituitary gland; lung and testis. Expressed at low levels in the brain. |
| Post Translational Modification | NA |
| Function | Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures; a major component of the gut-associated lymphoid tissue. |
| Length | 220 |
| Molecular Weight | 22878 |
| Name | Artemin |
| Sequence | GGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
| Sequence map | 111-40 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P56159; O00451; O60609 |
| Domain | NA |
| Pharmaceutical Use | NA
|