| Primary information |
|---|
| ID | 17172 |
| Uniprot ID | O75888 |
| Description | Tumor necrosis factor ligand superfamily member 13 (A proliferation-inducing ligand) (APRIL) (TNF- and APOL-related leukocyte expressed ligand 2) (TALL-2) (TNF-related death ligand 1) (TRDL-1) (CD antigen CD256) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed at high levels in transformed cell lines; cancers of colon; thyroid; lymphoid tissues and specifically expressed in monocytes and macrophages. |
| Post Translational Modification | The precursor is cleaved by furin. |
| Function | Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes. |
| Length | 250 |
| Molecular Weight | 27433 |
| Name | Tumor necrosis factor ligand superfamily member 13 |
| Sequence | VLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
| Sequence map | 109-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | O14836; Q02223 |
| Domain | NA |
| Pharmaceutical Use | NA
|