Detailed description page of Hmrbase2
| This page displays user query in tabular form. |
17114 details |
| Primary information | |
|---|---|
| ID | 17114 |
| Uniprot ID | Q8LLV8 |
| Description | POLARIS peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | POLARIS peptide family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Required for correct root growth and vascular development; probably by modulating both cell division rate in meristems and cell elongation in roots. Negative regulator of the ethylene signaling pathway that modulates microtubule cytoskeleton dynamics and auxin transport and homeostasis; and possibly cytokinin signaling; thus influencing root growth and lateral root development. |
| Length | 36 |
| Molecular Weight | 0 |
| Name | Peptide POLARIS |
| Sequence | MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA |