Detailed description page of Hmrbase2
| This page displays user query in tabular form. |
17111 details |
| Primary information | |
|---|---|
| ID | 17111 |
| Uniprot ID | Q9LV88 |
| Description | Brassicaceae elicitor peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Brassicaceae elicitor peptide family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Elicitor of plant defense. |
| Length | 36 |
| Molecular Weight | 0 |
| Name | Elicitor peptide 2 |
| Sequence | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA |