| Primary information |
|---|
| ID | 17105 |
| Uniprot ID | Q1G3V9 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Highly expressed in flowers; and at very low levels in leaves. |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Highly expressed in flowers; and at very low levels in leaves. |
| Post Translational Modification | NA |
| Function | Controls stomatal patterning. |
| Length | 54 |
| Molecular Weight | 0 |
| Name | EPIDERMAL PATTERNING FACTOR-like protein 8 |
| Sequence | MGSEPPVCATKCRNCKPCLPYLFDIRGAHDDDDDSEPYYPVKWICRCRDRVFEP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|