| Primary information |
|---|
| ID | 17102 |
| Uniprot ID | Q9LUH9 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed asymetically in the hypocotyl; on the side proximal to the folded cotyledons at germination. Detected in developing flowers; the chalazal region of ovules and near the root apex; but not in |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Expressed asymetically in the hypocotyl; on the side proximal to the folded cotyledons at germination. Detected in developing flowers; the chalazal region of ovules and near the root apex; but not in |
| Post Translational Modification | NA |
| Function | Controls stomatal patterning. Mediates differentiation of stomatal lineage cells to pavement cells and stomatal development inhibition. TMM (AC Q9SSD1) functions to dampen or block CLL1 signaling. Acts as growth-regulatory ligand for ERECTA family receptors. Promotes fruit growth and fertility. |
| Length | 85 |
| Molecular Weight | 0 |
| Name | EPIDERMAL PATTERNING FACTOR-like protein 5 |
| Sequence | ASLQRPSGGLGQGKKEIARSGLPGQIVDQKRLGGPGSVPPMCRLKCGKCEPCKAVHVPIQPGLIMPLEYYPEAWRCKCGNKLFMP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|