| Primary information |
|---|
| ID | 17101 |
| Uniprot ID | Q2V3I3 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed asymetically in the hypocotyl; on the side proximal to the folded cotyledons at germination. Detected in developing flowers; the chalazal region of ovules and near the root apex; but not in |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Expressed asymetically in the hypocotyl; on the side proximal to the folded cotyledons at germination. Detected in developing flowers; the chalazal region of ovules and near the root apex; but not in |
| Post Translational Modification | NA |
| Function | Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture. Redundantly involved with EPFL6 in procambial development regulation. Controls stomatal patterning. Mediates stomatal development inhibition. TMM (AC Q9SSD1) functions to dampen or block CLL2 signaling. |
| Length | 83 |
| Molecular Weight | 0 |
| Name | EPIDERMAL PATTERNING FACTOR-like protein 4 |
| Sequence | SSIVSADGRWIGQRTGSDLPGGFIRSNKRFGGPGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|