| Primary information |
|---|
| ID | 17100 |
| Uniprot ID | Q2V3I3 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed at the base of the apical meristem at 3 days after germination. Not detected in the hypocotyl. Expressed in developing stems soon after bolting; in inflorescence stems and in young siliques. |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Expressed at the base of the apical meristem at 3 days after germination. Not detected in the hypocotyl. Expressed in developing stems soon after bolting; in inflorescence stems and in young siliques. |
| Post Translational Modification | NA |
| Function | Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture. Redundantly involved with EPFL6 in procambial development regulation. Controls stomatal patterning. Mediates stomatal development inhibition. TMM (AC Q9SSD1) functions to dampen or block CLL2 signaling. |
| Length | 51 |
| Molecular Weight | 0 |
| Name | CHALLAH-LIKE2 |
| Sequence | PGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|