| Primary information |
|---|
| ID | 17099 |
| Uniprot ID | Q8S8I4 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed at the base of the apical meristem at 3 days after germination. Not detected in the hypocotyl. Expressed in developing stems soon after bolting; in inflorescence stems and in young siliques. |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Expressed at the base of the apical meristem at 3 days after germination. Not detected in the hypocotyl. Expressed in developing stems soon after bolting; in inflorescence stems and in young siliques. |
| Post Translational Modification | NA |
| Function | Controls stomatal patterning. Regulates asymmetric cell division during guard cell differentiation. Mediates stomatal development inhibition. Not cleaved by the protease CRSP (AC Q9LNU1).mobile signal controlling stomatal development in a non-cell-autonomous manner. Uses ERL1 as major receptor. May act by competing with somatogen (AC Q9SV72) for the same receptor; TMM (AC Q9SSD1). |
| Length | 52 |
| Molecular Weight | 0 |
| Name | MEPF1 |
| Sequence | AGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|