| Primary information |
|---|
| ID | 17098 |
| Uniprot ID | Q8LC53 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed in shoots; but not in roots. Mostly localized in developing leaves; specifically in meristemoids; guard mother cells (GMCs); and young guard cells. |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Expressed in shoots; but not in roots. Mostly localized in developing leaves; specifically in meristemoids; guard mother cells (GMCs); and young guard cells. |
| Post Translational Modification | NA |
| Function | Controls stomatal patterning. Regulates the number of cells that enter; and remain in; the stomatal lineage by inhibiting protodermal cells from adopting the meristemoid mother cell (MMC) fate in a non-cell-autonomous manner. Mediates stomatal development inhibition.mobile signal controlling stomatal development in a non-cell-autonomous manner. Inactivated by cleavage by CRSP (AC Q9LNU1) |
| Length | 52 |
| Molecular Weight | 0 |
| Name | MEPF2 |
| Sequence | TGSSLPDCSYACGACSPCKRVMISFECSVAESCSVIYRCTCRGRYYHVPSRA |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The loop (92-105) connecting the two anti-parallel |
| Pharmaceutical Use | NA
|