| Primary information |
|---|
| ID | 17097 |
| Uniprot ID | Q9SV72 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed in leaves; especially by the MMCs and their early descendants cells (stomatal lineage cells) including guard mother cells (GMCs). |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Expressed in leaves; especially by the MMCs and their early descendants cells (stomatal lineage cells) including guard mother cells (GMCs). |
| Post Translational Modification | NA |
| Function | Positively regulates stomatal density and patterning. |
| Length | 45 |
| Molecular Weight | 0 |
| Name | Stomagen |
| Sequence | IGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The loop (82-95) connecting the two anti-parallel |
| Pharmaceutical Use | NA
|