| Primary information |
|---|
| ID | 17096 |
| Uniprot ID | Q9SV72 |
| Description | Plant cysteine rich small secretory peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed in immature organs; including leaves; stems and flower buds; but not in roots; shoot apical meristem and petals. Detected in the mesophyll tissues but not in the epidermal tissues where stom |
| Similarity | Plant cysteine rich small secretory peptide family |
| Tissue Specificity | Expressed in immature organs; including leaves; stems and flower buds; but not in roots; shoot apical meristem and petals. Detected in the mesophyll tissues but not in the epidermal tissues where stom |
| Post Translational Modification | NA |
| Function | NA |
| Length | 71 |
| Molecular Weight | 0 |
| Name | EPIDERMAL PATTERNING FACTOR-like protein 9 |
| Sequence | SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The loop (82-95) connecting the two anti-parallel |
| Pharmaceutical Use | NA
|