| Primary information |
|---|
| ID | 17095 |
| Uniprot ID | Q6DUW9 |
| Description | NA |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed exclusively in the root stele. |
| Similarity | NA |
| Tissue Specificity | Expressed exclusively in the root stele. |
| Post Translational Modification | NA |
| Function | May be involved in floral abscission. |
| Length | 60 |
| Molecular Weight | 0 |
| Name | Protein IDA-LIKE 2 |
| Sequence | GARTNTNVFNSKPHKKHNDAVSSSTKQFLGFLPRHFPVPASGPSRKHNDIGLLSWHRSSP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|