| Primary information |
|---|
| ID | 17094 |
| Uniprot ID | Q6DUW6 |
| Description | NA |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed in leaves; buds; flowers; seedlings and seeds. Detected at the base of pedicel; in the floral and funicule abscission zones and in vascular tissues. |
| Similarity | NA |
| Tissue Specificity | Expressed in leaves; buds; flowers; seedlings and seeds. Detected at the base of pedicel; in the floral and funicule abscission zones and in vascular tissues. |
| Post Translational Modification | NA |
| Function | May be involved in floral abscission. |
| Length | 58 |
| Molecular Weight | 0 |
| Name | Protein IDA-LIKE 4 |
| Sequence | ASRFSSSSVFYRNPNYDHSNNTVRRGHFLGFLPRHLPVPASAPSRKHNDIGIQALLSP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|