| Primary information |
|---|
| ID | 17093 |
| Uniprot ID | Q6DUW7 |
| Description | NA |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed in mainly in buds. Lower levels in roots. Detected at the base of pedicel; in the floral and funicule abscission zones; in vascular tissues; in guard cells of young seedlings and in hydathod |
| Similarity | NA |
| Tissue Specificity | Expressed in mainly in buds. Lower levels in roots. Detected at the base of pedicel; in the floral and funicule abscission zones; in vascular tissues; in guard cells of young seedlings and in hydathod |
| Post Translational Modification | NA |
| Function | May be involved in floral abscission. |
| Length | 67 |
| Molecular Weight | 0 |
| Name | Protein IDA-LIKE 3 |
| Sequence | ARTTNVFNTSSPPKQKDVVSPPHDHVHHQVQDHKSVQFLGSLPRQFPVPTSGPSRKHNEIGLSSTKT |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|