| Primary information |
|---|
| ID | 17092 |
| Uniprot ID | Q29PV4 |
| Description | NA |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed in flowers and seedlings. Detected at the base of pedicel; in the floral abscission zone and in vascular tissues. |
| Similarity | NA |
| Tissue Specificity | Expressed in flowers and seedlings. Detected at the base of pedicel; in the floral abscission zone and in vascular tissues. |
| Post Translational Modification | NA |
| Function | Involved in an ethylene-independent separation step of floral abscission. |
| Length | 59 |
| Molecular Weight | 0 |
| Name | Protein IDA-LIKE 1 |
| Sequence | RIGPIKLSETEIVQTRSRQEIIGGFTFKGRVFHSFSKRVLVPPSGPSMRHNSVVNNLKH |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The N-terminal signal peptide is necessary for IDL |
| Pharmaceutical Use | NA
|