Primary information |
---|
ID | 17061 |
Uniprot ID | Q3EDH8 |
Description | CLV3/ESR signal peptide family |
Organism | Arabidopsis thaliana |
Txonomy | Viridiplantae |
Subcellular Location | secreted |
Developmental Stage | Mostly expressed in seedlings; roots; flowers; stems and apex; and; to a lower extent; in leaves and siliques. |
Similarity | CLV3/ESR signal peptide family |
Tissue Specificity | Mostly expressed in seedlings; roots; flowers; stems and apex; and; to a lower extent; in leaves and siliques. |
Post Translational Modification | T51 Hydroxyproline |
Function | Extracellular signal peptide that regulates cell fate. |
Length | 59 |
Molecular Weight | 0 |
Name | CLAVATA3/ESR (CLE)-related protein 3 |
Sequence | RPLVAEERFSGSSRLKKIRRELFERLKEMKGRSEGEETILGNTLDSKRLSPGGPDPRHH |
Sequence map | NA |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|