| Primary information |
|---|
| ID | 17061 |
| Uniprot ID | Q3EDH8 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Mostly expressed in seedlings; roots; flowers; stems and apex; and; to a lower extent; in leaves and siliques. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Mostly expressed in seedlings; roots; flowers; stems and apex; and; to a lower extent; in leaves and siliques. |
| Post Translational Modification | T51 Hydroxyproline |
| Function | Extracellular signal peptide that regulates cell fate. |
| Length | 59 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 3 |
| Sequence | RPLVAEERFSGSSRLKKIRRELFERLKEMKGRSEGEETILGNTLDSKRLSPGGPDPRHH |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|