| Primary information |
|---|
| ID | 17056 |
| Uniprot ID | Q8S8N3 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed specifically in the embryo surrounding region at the micropylar end of the seed endosperm at early stages (4 to 7 days after pollination; DAP) and ever-decreasing parts of the suspensor at s |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Expressed specifically in the embryo surrounding region at the micropylar end of the seed endosperm at early stages (4 to 7 days after pollination; DAP) and ever-decreasing parts of the suspensor at s |
| Post Translational Modification | T47 Hydroxyproline |
| Function | Extracellular signal peptide that regulates cell fate. |
| Length | 55 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 6 |
| Sequence | RILRTYRPTTMGDMDSQVLLRELGIDLSKFKGQDERRFLVDSERVSPGGPDPQHH |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|