| Primary information |
|---|
| ID | 17055 |
| Uniprot ID | Q3EDI6 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Mostly expressed in roots; seedlings; stems and flowers; and; to a lower extent; in apex and siliques. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Mostly expressed in roots; seedlings; stems and flowers; and; to a lower extent; in apex and siliques. |
| Post Translational Modification | NA |
| Function | Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Inhibits irreversibly root growth by reducing cell division rates in the root apical meristem. |
| Length | 54 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 20 |
| Sequence | SRIHVERRRFSSKPSGENREFLPSQPTFPVVDAGEILPDKRKVKTGSNPLHNKR |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|