| Primary information |
|---|
| ID | 17048 |
| Uniprot ID | Q9FZE4 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Highly expressed exclusively within the subventral esophageal gland cell during syncytium formation in host plants. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Highly expressed exclusively within the subventral esophageal gland cell during syncytium formation in host plants. |
| Post Translational Modification | T86 Hydroxyproline |
| Function | Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. |
| Length | 94 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 9 |
| Sequence | SSTVVDEGNRTSRNFRYRTHRFVPRFNHHPYHVTPHRSCDSFIRPYARSMCIELQRIHRSSRKQPLLSPPPPEIDPRYGVDKRLVPSGPNPLHN |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|