| Primary information |
|---|
| ID | 17037 |
| Uniprot ID | A0MH06 |
| Description | Protein FLORAL ORGAN NUMBER2 (OsFON2) (CLAVATA3-like protein) (Protein FLORAL ORGAN NUMBER4) |
| Organism | Oryza sativa subsp. japonica |
| Txonomy | Oryza sativa (species); Oryza ; Oryzinae (subtribe); Oryzeae (tribe); Oryzoideae ; BOP clade ; Poaceae ; Poales ; commelinids ; Petrosaviidae (subclass); Liliopsida ; Mesangiospermae ; Magnoliopsida ; Spermatophyta ; Euphyllophyta ; Tracheophyta ; Embryophyta ; Streptophytina ; Streptophyta ; Viridiplantae ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | Expressed during the development of the floral organ primordia. No longer detected after the carpel has formed. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Expressed in shoot apical and axillary meristems; but not in other vegetative tissues. Detected in a group of small cells at the apical region of the central zone of the meristems. |
| Post Translational Modification | NA |
| Function | Probable extracellular signal that regulates meristem maintenance. May function as a putative ligand for a receptor complex including FON1. Regulates the size of the floral meristem and the number of floral organs. |
| Length | 122 |
| Molecular Weight | 12 |
| Name | Protein FLORAL ORGAN NUMBER2 |
| Sequence | RVGLPGEFSGDQRPVPATSFDLVTEPKTKQPRGVKGTRRPSWSSWSSTASRSSPPPGRGAPSAAAAAELRSVPAGPDPMHHHGSPRRPEHARSTGRP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|