| Primary information |
|---|
| ID | 17035 |
| Uniprot ID | Q9LXU0 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Mostly expressed in flowers and siliques; and; to a lower extent; in roots; stems; apex; seedlings; leaves and pollen. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Mostly expressed in flowers and siliques; and; to a lower extent; in roots; stems; apex; seedlings; leaves and pollen. |
| Post Translational Modification | T40 Hydroxyproline |
| Function | Extracellular signal peptide secreted by differentiated root cells that regulates root cell fate. Acts with ACR4 as a ligand-receptor pair in a signal transduction pathway; coordinating movement of the root tip and organization of cell divisions in the root meristem. Promotes cell differentiation in the distal root meristem in a dose-dependent manner; especially the transition from columella stem cells (CSC) daughters into columella cells (CCs). Induces ACR4 expression in root quiescent center (QC). Involved in WUX5 QC-specific expression pattern regulation. |
| Length | 55 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 40 |
| Sequence | HSSSTKSFFWLGETQDTKAMKKEKKIDGGTANEVEERQVPTGSDPLHHKHIPFTP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|