| Primary information |
|---|
| ID | 17027 |
| Uniprot ID | Q3ECJ5 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Mostly expressed in roots; and; to a lower extent; in seedlings and leaves. Expressed in the primary root tip under Pi deficiency |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Mostly expressed in roots; and; to a lower extent; in seedlings and leaves. Expressed in the primary root tip under Pi deficiency |
| Post Translational Modification | T45 Hydroxyproline; |
| Function | Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Acts as an elicitor of the root meristem differentiation through the CLV2/CRN complex signaling pathway. Inhibits irreversibly root growth by reducing cell division rates in the root apical meristem. |
| Length | 54 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 14 |
| Sequence | GRKLPSMTTTEEFQRLSFDGKRILSEVTADKKYDRIYGASARLVPKGPNPLHNK |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|