| Primary information |
|---|
| ID | 17023 |
| Uniprot ID | Q6IWB2 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Expressed at low levels in seedlings; roots and inflorescence. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Expressed at low levels in seedlings; roots and inflorescence. |
| Post Translational Modification | T65 Hydroxyproline; |
| Function | Extracellular signal peptide that regulates cell fate. Represses tracheary element differentiation but promotes the formation of procambial cells. |
| Length | 62 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 42 |
| Sequence | RTIDQTHQIGSNVQHVSDMAVTSPEGKRRERFRVRRPMTTWLKGKMIGANEHGVPSGPNPISNR |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|