| Primary information |
|---|
| ID | 17019 |
| Uniprot ID | Q941C5 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | Mostly expressed in flowers and leaves. Widely expressed along the vascular strands. In roots and hypocotyls; present in endodermal cells as well as cells in the phloem and the adjacent pericycle. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | Mostly expressed in flowers and leaves. Widely expressed along the vascular strands. In roots and hypocotyls; present in endodermal cells as well as cells in the phloem and the adjacent pericycle. |
| Post Translational Modification | T55 Hydroxyproline; |
| Function | Extracellular signal peptide that regulates cell fate. May act with TDR as a ligand-receptor pair in a signal transduction pathway that represses tracheary element differentiation but promotes the formation of procambial cells adjacent to phloem cells in the veins. |
| Length | 72 |
| Molecular Weight | 0 |
| Name | CLAVATA3/ESR (CLE)-related protein 44 |
| Sequence | MNHHLHESSSKNTMAPSKRFLLQPSTPSSSTMKMRPTAHPRRSGTSSSSARKRRREFRAEAHEVPSGPNPISN |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|