| Primary information |
|---|
| ID | 17017 |
| Uniprot ID | Q9XF04 |
| Description | CLV3/ESR signal peptide family |
| Organism | Arabidopsis thaliana |
| Txonomy | Viridiplantae |
| Subcellular Location | secreted |
| Developmental Stage | First detected in heart stage embryos in a patch of cells between the developing cotyledons. In vegetative and inflorescence meristems; expressed in a small cone of cells at the meristem apex. |
| Similarity | CLV3/ESR signal peptide family |
| Tissue Specificity | First detected in heart stage embryos in a patch of cells between the developing cotyledons. In vegetative and inflorescence meristems; expressed in a small cone of cells at the meristem apex. |
| Post Translational Modification | T52 Hydroxyproline; |
| Function | Extracellular signal that regulates meristem maintenance. Acts with CLV1 as a ligand-receptor pair in a signal transduction pathway coordinating growth between adjacent meristematic regions and controlling the balance between meristem cell proliferation and differentiation |
| Length | 75 |
| Molecular Weight | 0 |
| Name | Protein CLAVATA 3 |
| Sequence | SDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|