| Primary information |
|---|
| ID | 17013 |
| Uniprot ID | P0CG34 |
| Description | FMRFamide-like neuropeptide RYIRF-amide |
| Organism | Human |
| Txonomy | Arthurdendyus ; Caenoplaninae ; Geoplanidae ; Geoplanoidea ; Continenticola ; Tricladida ; Seriata ; Rhabditophora ; Platyhelminthes ; Lophotrochozoa ; Spiralia ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Thymosin beta family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. |
| Length | 5 |
| Molecular Weight | 754 |
| Name | Thymosin beta-15A |
| Sequence | SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|