| Primary information |
|---|
| ID | 16692 |
| Uniprot ID | NA |
| Description | Sauvagine/corticotropin-releasing factor/urotensin I family |
| Organism | Hippoglossoides elassodon |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Cyclostomata; Hyperoartia; Petromyzontiformes; Petromyzontidae; Lampetra |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Sauvagine/corticotropin-releasing factor/urotensin I family |
| Tissue Specificity | NA |
| Post Translational Modification | T38 Valine amide |
| Function | Have the vasodilatation and ACTH-releasing effects |
| Length | 38 |
| Molecular Weight | 0 |
| Name | urotensin I |
| Sequence | SEEPPMSDLTFHMLRNMHRAKMEGEREQALNRNLLDEV |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|