Primary information |
---|
ID | 15973 |
Uniprot ID | P81117 |
Description | Periviscerokinin-2 (CryKy-PVK-2) |
Organism | Mus musculus |
Txonomy | Cryptocercus ; Cryptocercidae ; Blattoidea ; Blattodea ; Dictyoptera ; Polyneoptera (cohort); Neoptera (infraclass); Pterygota (subclass); Dicondylia ; Insecta ; Hexapoda ; Pancrustacea ; Mandibulata ; Arthropoda ; Panarthropoda ; Ecdysozoa ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
Subcellular Location | secreted |
Developmental Stage | NA |
Similarity | Nucleobindin family |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Play an important role in hypothalamic pathways regulating food intake and energy homeostasis; acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance. |
Length | 11 |
Molecular Weight | 1 |
Name | Nesfatin-1 |
Sequence | VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL |
Sequence map | NA |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The GBA (G-alpha binding and activating) motif med |
Pharmaceutical Use | NA
|