| Primary information |
|---|
| ID | 15973 |
| Uniprot ID | P81117 |
| Description | Periviscerokinin-2 (CryKy-PVK-2) |
| Organism | Mus musculus |
| Txonomy | Cryptocercus ; Cryptocercidae ; Blattoidea ; Blattodea ; Dictyoptera ; Polyneoptera (cohort); Neoptera (infraclass); Pterygota (subclass); Dicondylia ; Insecta ; Hexapoda ; Pancrustacea ; Mandibulata ; Arthropoda ; Panarthropoda ; Ecdysozoa ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Nucleobindin family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Play an important role in hypothalamic pathways regulating food intake and energy homeostasis; acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance. |
| Length | 11 |
| Molecular Weight | 1 |
| Name | Nesfatin-1 |
| Sequence | VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The GBA (G-alpha binding and activating) motif med |
| Pharmaceutical Use | NA
|