| Primary information |
|---|
| ID | 15972 |
| Uniprot ID | P80303 |
| Description | Periviscerokinin-3 (CryDa-PVK-3) |
| Organism | Homo sapiens |
| Txonomy | Cryptocercus ; Cryptocercidae ; Blattoidea ; Blattodea ; Dictyoptera ; Polyneoptera (cohort); Neoptera (infraclass); Pterygota (subclass); Dicondylia ; Insecta ; Hexapoda ; Pancrustacea ; Mandibulata ; Arthropoda ; Panarthropoda ; Ecdysozoa ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Nucleobindin family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Be involved in food intake and energy homeostasis regulation;modulate the cardiovascular function at different levels;promotes insulin release and signaling |
| Length | 11 |
| Molecular Weight | 1 |
| Name | Nesfatin-1 |
| Sequence | VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The GBA (G-alpha binding and activating) motif med |
| Pharmaceutical Use | NA
|