| Primary information |
|---|
| ID | 15852 |
| Uniprot ID | Q8N729 |
| Description | Neuropeptide B/W family |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | secreted |
| Developmental Stage | Detected in brain; more specifically in paraventricular hypothalamic nucleus; hippocampus and several nuclei in midbrain and brainstem. |
| Similarity | Neuropeptide B/W family |
| Tissue Specificity | Detected in brain; more specifically in paraventricular hypothalamic nucleus; hippocampus and several nuclei in midbrain and brainstem. |
| Post Translational Modification | NA |
| Function | Plays a regulatory role in the organization of neuroendocrine signals accessing the anterior pituitary gland. Stimulates water drinking and food intake. May play a role in the hypothalamic response to stress |
| Length | 30 |
| Molecular Weight | 0 |
| Name | Neuropeptide W-30 |
| Sequence | WYKHVASPRYHTVGRAAGLLMGLRRSPYLW |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P48145; P48146; P48145; P48146 |
| Domain | NA |
| Pharmaceutical Use | NA
|